PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00701.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 386aa    MW: 43064.4 Da    PI: 6.0434
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00701.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.5e-05234335
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                             e+kC+ +   +++++C+ +   lC +C ++ H+
  Rsa1.0_00701.1_g00004.1  2 EPKCDYCATTQAIIYCKYDLAKLCLNCDVHVHS 34
                             689******99******************9994 PP

2CCT62.31.5e-21329372144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a+lRYkeK+ +R F K+irY+sRKa+A++R+RvKGrFvk+ 
  Rsa1.0_00701.1_g00004.1 329 RNEAKLRYKEKKLKRTFGKQIRYASRKARADTRKRVKGRFVKAG 372
                              99***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.4E-6147IPR000315B-box-type zinc finger
CDDcd000210.00275334No hitNo description
PROSITE profilePS5101714.436329371IPR010402CCT domain
PfamPF062035.3E-16329371IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEPKCDYCAT TQAIIYCKYD LAKLCLNCDV HVHSPNPLSR RHMRSLICDK CFSQPGIIQC  60
LDHKVSYCQG CQWHVSNCSA LGHRLQRLDP FSGCPSRTEF SRMWSSILES SVSSSVKPSI  120
GSLPLVDPNN DMFNMSKINE LDDLIGSSYS VMSQNNTYIQ NLSDQSSFFS GDSKGCPDLL  180
LKLEEGEEDL CEGLNLDNAP LNFDVGDDII CCSPQEHIES DHTLPNGLFV YKNIISVTDS  240
NFTTDNPLEA TSTGQKDCKS YQQSGPLQMN INIGLPLPTS PILFGQINPN IKGHESPVVD  300
YQDCGMSTGF IMSDSPWESN LDVGSPQARN EAKLRYKEKK LKRTFGKQIR YASRKARADT  360
RKRVKGRFVK AGDNYDYDPS SPTTNQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013731345.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like
SwissprotQ9LJ440.0COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLA0A078J1600.0A0A078J160_BRANA; BnaA01g36580D protein
STRINGBra023858.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-164B-box type zinc finger protein with CCT domain